
Research-grade peptide
GLOW (BPC 157 10mg+GHK-CU 50mg+TB500 10mg)
A lyophilized research peptide supplied for laboratory research use only. Each batch ships with a published certificate of analysis.
Strength
Quantity per order
In production
This peptide is being produced now, so its certificate of analysis (COA) isn't available yet — each batch goes on sale only once its own COA is published. You can follow its progress in the timeline below, Est Ready Oct 2026.
For research use only — not for human consumption.
Specifications
- Peptide
- GLOW (BPC 157 10mg+GHK-CU 50mg+TB500 10mg)
- CAS number
- 89030-95-5, 137525-51-0, 77591-33-4
- Molecular formula
- C14H24CUN6O4, C62H98N16O22, C212H350N56O78S
- Sequence
- GlyHisLys, GEPPPGKPADDAGLV, SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Physical form
- Lyophilized powder
Shipped cold. Packed with dry ice in insulated packaging so the compound's structure stays intact in transit — A to Z. How we ship.
Made to standard. Produced and assembled at our partner facility in Texas, then held in temperature-controlled, stable storage.
Ships the same day you order, with most deliveries arriving within two days. See shipping & returns.
FDA status
These statements have not been evaluated by the U.S. Food and Drug Administration (FDA). This product is not FDA-approved and is not intended to diagnose, treat, cure, or prevent any disease. It is sold strictly as a research chemical for laboratory and research use only — not for human or animal consumption. Read more about FDA status.
In production
This peptide is being produced now. Its certificate of analysis will be published before it goes on sale — here's where the batch is in the pipeline.
Production progress
Est Ready Oct 2026
Currently produced at our partner facility in Texas. This peptide goes on sale only once its certificate of analysis is published — Est Ready Oct 2026.
About this compound
Also known as GLOW Blend · GHK-Cu / BPC-157 / TB-500 · Glow Stack
GLOW is a research blend combining three synthetic peptides — GHK-Cu, BPC-157, and TB-500 — co-lyophilised in a single vial. It is studied in laboratory research contexts for the individual and combined signalling behaviour of its components across tissue-repair and extracellular-matrix pathways.
Elisvon supplies it as a lyophilised (freeze-dried) powder, sealed and intended strictly for in-vitro and laboratory research use.
Information is provided for research reference only. Nothing here is a medical, therapeutic, or dosing claim.


